Lineage for d1hkva2 (1hkv A:46-310)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969456Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 969457Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 969484Protein Diaminopimelate decarboxylase LysA [89457] (3 species)
    most similar to eukaryotic ODC
  7. 969495Species Mycobacterium tuberculosis [TaxId:1773] [89458] (2 PDB entries)
  8. 969496Domain d1hkva2: 1hkv A:46-310 [83560]
    Other proteins in same PDB: d1hkva1, d1hkvb1
    complexed with lys, plp

Details for d1hkva2

PDB Entry: 1hkv (more details), 2.6 Å

PDB Description: mycobacterium diaminopimelate dicarboxylase (lysa)
PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1hkva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkva2 c.1.6.1 (A:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]}
deddfrsrcretaaafgsganvhyaakaflcsevarwiseeglcldvctggelavalhas
fpperitlhgnnksvseltaavkagvghivvdsmteierldaiageagivqdvlvrltvg
veahthefistahedqkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfe
laahrvigllrdvvgefgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsd
estavglptpklvvepgraiagpgt

SCOPe Domain Coordinates for d1hkva2:

Click to download the PDB-style file with coordinates for d1hkva2.
(The format of our PDB-style files is described here.)

Timeline for d1hkva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkva1