Lineage for d1hkua1 (1hku A:115-307)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388130Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 388225Protein Transcription corepressor CtbP [82298] (2 species)
    C-terminal binding protein 1; a dehydrogenase
  7. 388228Species Rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89529] (2 PDB entries)
  8. 388229Domain d1hkua1: 1hku A:115-307 [83557]
    Other proteins in same PDB: d1hkua2
    complexed with cea, fmt, gol, nad

Details for d1hkua1

PDB Entry: 1hku (more details), 2.3 Å

PDB Description: ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission

SCOP Domain Sequences for d1hkua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkua1 c.2.1.4 (A:115-307) Transcription corepressor CtbP {Rat (Rattus norvegicus), Ctbp3}
eetadstlchilnlyrrttwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgieralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

SCOP Domain Coordinates for d1hkua1:

Click to download the PDB-style file with coordinates for d1hkua1.
(The format of our PDB-style files is described here.)

Timeline for d1hkua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkua2