Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Transcription corepressor CtbP [82298] (2 species) C-terminal binding protein 1; a dehydrogenase |
Species Rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89529] (2 PDB entries) |
Domain d1hkua1: 1hku A:115-307 [83557] Other proteins in same PDB: d1hkua2 complexed with cea, fmt, gol, nad |
PDB Entry: 1hku (more details), 2.3 Å
SCOP Domain Sequences for d1hkua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkua1 c.2.1.4 (A:115-307) Transcription corepressor CtbP {Rat (Rattus norvegicus), Ctbp3} eetadstlchilnlyrrttwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv gqavalrakafgfnvlfydpylsdgieralglqrvstlqdllfhsdcvtlhcglnehnhh lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk dapnlictphaaw
Timeline for d1hkua1: