SCOPe 2.08: Domain d1hkua1: 1hku A:115-307

Lineage for d1hkua1 (1hku A:115-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Transcription corepressor CtbP [82298] (2 species)
   C-terminal binding protein 1; a dehydrogenase

7. Species Norway rat (Rattus norvegicus), Ctbp3 [TaxId:10116] [89529] (2 PDB entries)

8. Domain d1hkua1: 1hku A:115-307 [83557]
   Other proteins in same PDB: d1hkua2
   complexed with fmt, gol, nad

Details for d1hkua1

PDB Entry: 1hku, 2.3 Å

PDB Description: ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission

PDB Compounds: (A:) c-terminal binding protein 3

SCOPe Domain Sequences for d1hkua1:

Sequence; same for both SEQRES and ATOM records:

>d1hkua1 c.2.1.4 (A:115-307) Transcription corepressor CtbP {Norway rat (Rattus norvegicus), Ctbp3 [TaxId: 10116]}
eetadstlchilnlyrrttwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgieralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

Timeline for d1hkua1:

• d1hkua1 first appeared in SCOP 1.65
  
• d1hkua1 appears in SCOPe 2.07