Lineage for d1hkea_ (1hke A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338490Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 338491Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 338492Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 338493Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 338497Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry)
  8. 338498Domain d1hkea_: 1hke A: [83549]
    Other proteins in same PDB: d1hkec_, d1hked_

Details for d1hkea_

PDB Entry: 1hke (more details), 1.8 Å

PDB Description: ivy:a new family of protein

SCOP Domain Sequences for d1hkea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkea_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa}
eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck
phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk
qlesdpnwkl

SCOP Domain Coordinates for d1hkea_:

Click to download the PDB-style file with coordinates for d1hkea_.
(The format of our PDB-style files is described here.)

Timeline for d1hkea_:

  • d1hkea_ is new in SCOP 1.65
  • d1hkea_ became obsolete in SCOP 1.67