SCOPe 2.04: Domain d1hk3a3: 1hk3 A:389-575

Lineage for d1hk3a3 (1hk3 A:389-575)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
   Uniprot P02768 29-596

8. Domain d1hk3a3: 1hk3 A:389-575 [83532]
   complexed with t44; mutant

Details for d1hk3a3

PDB Entry: 1hk3, 2.8 Å

PDB Description: human serum albumin mutant r218p complexed with thyroxine (3,3',5,5'- tetraiodo-l-thyronine)

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1hk3a3:

Sequence; same for both SEQRES and ATOM records:

>d1hk3a3 a.126.1.1 (A:389-575) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkkl

Timeline for d1hk3a3:

• d1hk3a3 first appeared in SCOP 1.65
  
• d1hk3a3 appears in SCOPe 2.03
  
• d1hk3a3 appears in SCOPe 2.05
  
• d1hk3a3 appears in the current release, SCOPe 2.08