Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries) Uniprot P02768 29-596 |
Domain d1hk1a2: 1hk1 A:197-388 [83525] complexed with t44 |
PDB Entry: 1hk1 (more details), 2.65 Å
SCOPe Domain Sequences for d1hk1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hk1a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde fkplveepqnli
Timeline for d1hk1a2: