SCOPe 2.01: Domain d1hjxb1: 1hjx B:22-260,B:329-383

Lineage for d1hjxb1 (1hjx B:22-260,B:329-383)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)

8. Domain d1hjxb1: 1hjx B:22-260,B:329-383 [83514]
   Other proteins in same PDB: d1hjxa2, d1hjxb2, d1hjxc2, d1hjxd2
   complexed with gol, so4

Details for d1hjxb1

PDB Entry: 1hjx, 1.85 Å

PDB Description: ligand-induced signalling and conformational change of the 39 kd glycoprotein from human articular chondrocytes

PDB Compounds: (B:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjxb1:

Sequence; same for both SEQRES and ATOM records:

>d1hjxb1 c.1.8.5 (B:22-260,B:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

Timeline for d1hjxb1:

• d1hjxb1 first appeared in SCOP 1.65
  
• d1hjxb1 appears in SCOP 1.75
  
• d1hjxb1 appears in SCOPe 2.02
  
• d1hjxb1 appears in the current release, SCOPe 2.08