Lineage for d1hjxa1 (1hjx A:22-260,A:329-383)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385232Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)
  7. 385233Species Human (Homo sapiens) [TaxId:9606] [89483] (7 PDB entries)
  8. 385234Domain d1hjxa1: 1hjx A:22-260,A:329-383 [83512]
    Other proteins in same PDB: d1hjxa2, d1hjxb2, d1hjxc2, d1hjxd2

Details for d1hjxa1

PDB Entry: 1hjx (more details), 1.85 Å

PDB Description: ligand-induced signalling and conformational change of the 39 kd glycoprotein from human articular chondrocytes

SCOP Domain Sequences for d1hjxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjxa1 c.1.8.5 (A:22-260,A:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens)}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

SCOP Domain Coordinates for d1hjxa1:

Click to download the PDB-style file with coordinates for d1hjxa1.
(The format of our PDB-style files is described here.)

Timeline for d1hjxa1: