SCOPe 2.08: Domain d1hjvd1: 1hjv D:22-260,D:329-383

Lineage for d1hjvd1 (1hjv D:22-260,D:329-383)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89482] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89483] (8 PDB entries)

8. Domain d1hjvd1: 1hjv D:22-260,D:329-383 [83506]
   Other proteins in same PDB: d1hjva2, d1hjvb2, d1hjvc2, d1hjvd2
   complexed with nag, so4

Details for d1hjvd1

PDB Entry: 1hjv, 2.75 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin tetramer

PDB Compounds: (D:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjvd1:

Sequence; same for both SEQRES and ATOM records:

>d1hjvd1 c.1.8.5 (D:22-260,D:329-383) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
yklvcyytswsqyregdgscfpdaldrflcthiiysfanisndhidtwewndvtlygmln
tlknrnpnlktllsvggwnfgsqrfskiasntqsrrtfiksvppflrthgfdgldlawly
pgrrdkqhfttlikemkaefikeaqpgkkqlllsaalsagkvtidssydiakisqhldfi
simtydfhgawrgttghhsplfrgqedaspdrfsntdyavgymlrlgapasklvmgiptX
ddqesvkskvqylkdrqlagamvwaldlddfqgsfcgqdlrfpltnaikdalaat

Timeline for d1hjvd1:

• d1hjvd1 first appeared in SCOP 1.65
  
• d1hjvd1 appears in SCOPe 2.07