SCOP 1.75: Domain d1hjvb2: 1hjv B:261-328

Lineage for d1hjvb2 (1hjv B:261-328)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)

8. Domain d1hjvb2: 1hjv B:261-328 [83503]
   Other proteins in same PDB: d1hjva1, d1hjvb1, d1hjvc1, d1hjvd1

Details for d1hjvb2

PDB Entry: 1hjv, 2.75 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin tetramer

PDB Compounds: (B:) chitinase-3 like protein 1

SCOP Domain Sequences for d1hjvb2:

Sequence; same for both SEQRES and ATOM records:

>d1hjvb2 d.26.3.1 (B:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

Timeline for d1hjvb2:

• d1hjvb2 first appeared in SCOP 1.65
  
• d1hjvb2 appears in SCOP 1.73
  
• d1hjvb2 appears in SCOPe 2.01
  
• d1hjvb2 appears in the current release, SCOPe 2.08