Lineage for d1hjuc_ (1hju C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 815772Protein Beta-1,4-galactanase [89469] (4 species)
  7. 815789Species Thielavia heterothallica, aka Myceliophthora thermophila [TaxId:78579] [89471] (2 PDB entries)
    Myceliophthora thermophila is the anamorph name whilst Thielavia heterothallica is the teleomorph name
  8. 815796Domain d1hjuc_: 1hju C: [83498]

Details for d1hjuc_

PDB Entry: 1hju (more details), 2.15 Å

PDB Description: structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
PDB Compounds: (C:) beta-1,4-galactanase

SCOP Domain Sequences for d1hjuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjuc_ c.1.8.3 (C:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]}
altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
ihnanlgsscadntmfsqsgqalsslsvfqri

SCOP Domain Coordinates for d1hjuc_:

Click to download the PDB-style file with coordinates for d1hjuc_.
(The format of our PDB-style files is described here.)

Timeline for d1hjuc_: