SCOP 1.75: Domain d1h3jb_: 1h3j B:

Lineage for d1h3jb_ (1h3j B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Fungal peroxidase (ligninase) [88935] (4 species)

7. Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)

8. Domain d1h3jb_: 1h3j B: [83470]
   complexed with bma, ca, hem, hso, mg, nag

Details for d1h3jb_

PDB Entry: 1h3j, 2 Å

PDB Description: structure of recombinant coprinus cinereus peroxidase determined to 2.0 a

PDB Compounds: (B:) Peroxidase

SCOP Domain Sequences for d1h3jb_:

Sequence; same for both SEQRES and ATOM records:

>d1h3jb_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

Timeline for d1h3jb_:

• d1h3jb_ first appeared in SCOP 1.65
  
• d1h3jb_ appears in SCOP 1.73
  
• d1h3jb_ appears in SCOPe 2.01
  
• d1h3jb_ appears in the current release, SCOPe 2.08