![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (4 proteins) |
![]() | Protein Fungal peroxidase (ligninase) [88935] (4 species) |
![]() | Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries) |
![]() | Domain d1h3jb_: 1h3j B: [83470] complexed with bma, ca, hem, hso, mg, nag |
PDB Entry: 1h3j (more details), 2 Å
SCOP Domain Sequences for d1h3jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3jb_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]} svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv ipggltvddievscpsepfpeiatasgplpslapap
Timeline for d1h3jb_: