Lineage for d1h3ja_ (1h3j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720218Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2720249Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 2720256Domain d1h3ja_: 1h3j A: [83469]
    complexed with bma, ca, hem, mg

Details for d1h3ja_

PDB Entry: 1h3j (more details), 2 Å

PDB Description: structure of recombinant coprinus cinereus peroxidase determined to 2.0 a
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1h3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ja_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1h3ja_:

Click to download the PDB-style file with coordinates for d1h3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1h3ja_: