Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Grb2-related adaptor protein 2 (Mona/Gads) [89293] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [89294] (3 PDB entries) |
Domain d1h3ha_: 1h3h A: [83468] C-terminal domain; complexed with an RxxK-containing slp-76 peptide, chain B |
PDB Entry: 1h3h (more details)
SCOPe Domain Sequences for d1h3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ha_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} grvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
Timeline for d1h3ha_: