Lineage for d1h1ta_ (1h1t A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (4 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (2 species) 
Species Escherichia coli [TaxId:562] [52399] (4 PDB entries) 
Domain d1h1ta_: 1h1t A: [83458]
Details for d1h1ta_
PDB Entry: 1h1t (more details), 1.78 Å
PDB Description: phosphopantetheine adenylyltransferase in complex with coenzyme a from escherichia coli
SCOP Domain Sequences for d1h1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla
SCOP Domain Coordinates for d1h1ta_:
Click to download the PDB-style file with coordinates for d1h1ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h1ta_:
- d1h1ta_ is new in SCOP 1.65
- d1h1ta_ appears in SCOP 1.67
- d1h1ta_ appears in the current release, SCOPe 2.08
View in 3D
