![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins) duplication: consists of two cytochrome c type domains |
![]() | Protein Cytochrome c4 [46681] (2 species) |
![]() | Species Thiobacillus ferrooxidans [TaxId:920] [88972] (1 PDB entry) |
![]() | Domain d1h1ob2: 1h1o B:294-383 [83457] complexed with gol, hem, so4, zn |
PDB Entry: 1h1o (more details), 2.13 Å
SCOPe Domain Sequences for d1h1ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1ob2 a.3.1.4 (B:294-383) Cytochrome c4 {Thiobacillus ferrooxidans [TaxId: 920]} gikhagakegkaifnqgvtneqipacmechgsdgqgagpfprlagqrygyiiqqltyfhn gtrvntlmnqiaknitvaqmkdvaaylssl
Timeline for d1h1ob2: