Lineage for d1h1oa2 (1h1o A:94-183)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257655Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
    duplication: consists of two cytochrome c type domains
  6. 1257656Protein Cytochrome c4 [46681] (2 species)
  7. 1257678Species Thiobacillus ferrooxidans [TaxId:920] [88972] (1 PDB entry)
  8. 1257680Domain d1h1oa2: 1h1o A:94-183 [83455]
    complexed with gol, hem, so4, zn

Details for d1h1oa2

PDB Entry: 1h1o (more details), 2.13 Å

PDB Description: acidithiobacillus ferrooxidans cytochrome c4 structure supports a complex-induced tuning of electron transfer
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d1h1oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1oa2 a.3.1.4 (A:94-183) Cytochrome c4 {Thiobacillus ferrooxidans [TaxId: 920]}
gikhagakegkaifnqgvtneqipacmechgsdgqgagpfprlagqrygyiiqqltyfhn
gtrvntlmnqiaknitvaqmkdvaaylssl

SCOPe Domain Coordinates for d1h1oa2:

Click to download the PDB-style file with coordinates for d1h1oa2.
(The format of our PDB-style files is described here.)

Timeline for d1h1oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h1oa1