Lineage for d1h1ga_ (1h1g A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295610Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 295611Family b.34.2.1: SH3-domain [50045] (26 proteins)
  6. 295633Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 295634Species Chicken (Gallus gallus) [TaxId:9031] [50059] (17 PDB entries)
  8. 295644Domain d1h1ga_: 1h1g A: [83453]
    mutant

Details for d1h1ga_

PDB Entry: 1h1g (more details), 2.6 Å

PDB Description: a-spectrin sh3 domain a56s mutant

SCOP Domain Sequences for d1h1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ga_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld

SCOP Domain Coordinates for d1h1ga_:

Click to download the PDB-style file with coordinates for d1h1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ga_:

  • d1h1ga_ is new in SCOP 1.65
  • d1h1ga_ became obsolete in SCOP 1.67