Lineage for d1h0jc_ (1h0j C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259133Protein Cardiotoxin III [57337] (1 species)
  7. 2259134Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57338] (6 PDB entries)
    Uniprot P60301 22-81
  8. 2259137Domain d1h0jc_: 1h0j C: [83434]
    complexed with sds

Details for d1h0jc_

PDB Entry: 1h0j (more details), 1.9 Å

PDB Description: structural basis of the membrane-induced cardiotoxin a3 oligomerization
PDB Compounds: (C:) cardiotoxin-3

SCOPe Domain Sequences for d1h0jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0jc_ g.7.1.1 (C:) Cardiotoxin III {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn

SCOPe Domain Coordinates for d1h0jc_:

Click to download the PDB-style file with coordinates for d1h0jc_.
(The format of our PDB-style files is described here.)

Timeline for d1h0jc_: