Lineage for d1h0fa_ (1h0f A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324613Protein Angiogenin [54094] (2 species)
  7. 324617Species Human (Homo sapiens) [TaxId:9606] [54095] (18 PDB entries)
  8. 324618Domain d1h0fa_: 1h0f A: [83431]
    mutant

Details for d1h0fa_

PDB Entry: 1h0f (more details), 1.7 Å

PDB Description: structure of t44d hang mutant

SCOP Domain Sequences for d1h0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0fa_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens)}
dnsrythfltqhydakpqgrddrycesimrrrgltspckdindfihgnkrsikaicenkn
gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqs

SCOP Domain Coordinates for d1h0fa_:

Click to download the PDB-style file with coordinates for d1h0fa_.
(The format of our PDB-style files is described here.)

Timeline for d1h0fa_:

  • d1h0fa_ is new in SCOP 1.65
  • d1h0fa_ became obsolete in SCOP 1.67