SCOPe 2.07: Domain d1h0da2: 1h0d A:107-211

Lineage for d1h0da2 (1h0d A:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1h0da2: 1h0d A:107-211 [83426]
   Other proteins in same PDB: d1h0da1, d1h0db1, d1h0db2, d1h0dc_
   part of anti-angiogenin FAB; conflict: annotated in PDB as human
   complexed with gol, so4

Details for d1h0da2

PDB Entry: 1h0d, 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f

PDB Compounds: (A:) antibody fab fragment, light chain

SCOPe Domain Sequences for d1h0da2:

Sequence; same for both SEQRES and ATOM records:

>d1h0da2 b.1.1.2 (A:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathaaspivksfnrnec

Timeline for d1h0da2:

• d1h0da2 first appeared in SCOP 1.65
  
• d1h0da2 appears in SCOPe 2.06
  
• d1h0da2 appears in the current release, SCOPe 2.08