Lineage for d1gzoa_ (1gzo A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334933Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 334934Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 334971Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
    members organised in the groups and subfamiles specified by the comments
  6. 335266Protein Pkb kinase [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 335267Species Human (Homo sapiens) [TaxId:9606] [82792] (5 PDB entries)
  8. 335272Domain d1gzoa_: 1gzo A: [83408]

Details for d1gzoa_

PDB Entry: 1gzo (more details), 2.75 Å

PDB Description: structure of protein kinase b unphosphorylated

SCOP Domain Sequences for d1gzoa_:

Sequence, based on SEQRES records: (download)

>d1gzoa_ d.144.1.7 (A:) Pkb kinase {Human (Homo sapiens)}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfdde

Sequence, based on observed residues (ATOM records): (download)

>d1gzoa_ d.144.1.7 (A:) Pkb kinase {Human (Homo sapiens)}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkevivtesrvlqntrhpflta
lkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyr
diklenlmldkdghikitdfgltpeylapevledndygravdwwglgvvmyemmcgrlpf
ynqdherlfelilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrffl
sinwqdvvqkkllppfkpqvtsevdtryfdde

SCOP Domain Coordinates for d1gzoa_:

Click to download the PDB-style file with coordinates for d1gzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gzoa_: