Lineage for d1gzka_ (1gzk A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875059Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 875060Species Human (Homo sapiens) [TaxId:9606] [82792] (14 PDB entries)
  8. 875074Domain d1gzka_: 1gzk A: [83406]

Details for d1gzka_

PDB Entry: 1gzk (more details), 2.3 Å

PDB Description: molecular mechanism for the regulation of protein kinase b/ akt by hydrophobic motif phosphorylation
PDB Compounds: (A:) rac-beta serine/threonine protein kinase

SCOP Domain Sequences for d1gzka_:

Sequence, based on SEQRES records: (download)

>d1gzka_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfdd

Sequence, based on observed residues (ATOM records): (download)

>d1gzka_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkevivtesrvlqntrhpflta
lkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyr
diklenlmldkdghikitdfgltpeylapevledndygravdwwglgvvmyemmcgrlpf
ynqdherlfelilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrffl
sinwqdvvqkkllppfkpqvtsevdtryfdd

SCOP Domain Coordinates for d1gzka_:

Click to download the PDB-style file with coordinates for d1gzka_.
(The format of our PDB-style files is described here.)

Timeline for d1gzka_: