SCOPe 2.08: Domain d1gx4a_: 1gx4 A:

Lineage for d1gx4a_ (1gx4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
   Uniprot P14769

8. Domain d1gx4a_: 1gx4 A: [83362]
   complexed with gol, mn, udp

Details for d1gx4a_

PDB Entry: 1gx4, 1.46 Å

PDB Description: alpha-,1,3 galactosyltransferase - n-acetyl lactosamine complex

PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d1gx4a_:

Sequence; same for both SEQRES and ATOM records:

>d1gx4a_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

Timeline for d1gx4a_:

• d1gx4a_ first appeared in SCOP 1.65
  
• d1gx4a_ appears in SCOPe 2.07