Lineage for d1gufb1 (1guf B:23-160,B:350-386)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785486Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 2785487Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)
  8. 2785505Domain d1gufb1: 1guf B:23-160,B:350-386 [83330]
    Other proteins in same PDB: d1gufa2, d1gufb2
    complexed with gol, ndp, so4

Details for d1gufb1

PDB Entry: 1guf (more details), 2.25 Å

PDB Description: enoyl thioester reductase from candida tropicalis
PDB Compounds: (B:) enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial

SCOPe Domain Sequences for d1gufb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gufb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOPe Domain Coordinates for d1gufb1:

Click to download the PDB-style file with coordinates for d1gufb1.
(The format of our PDB-style files is described here.)

Timeline for d1gufb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gufb2