SCOP 1.73: Domain d1guba_: 1gub A:

Lineage for d1guba_ (1gub A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein D-allose-binding protein [53828] (1 species)

7. Species Escherichia coli [TaxId:562] [53829] (3 PDB entries)

8. Domain d1guba_: 1gub A: [83325]
   complexed with ni

Details for d1guba_

PDB Entry: 1gub, 3.1 Å

PDB Description: hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations

PDB Compounds: (A:) d-allose-binding periplasmic protein

SCOP Domain Sequences for d1guba_:

Sequence; same for both SEQRES and ATOM records:

>d1guba_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

Timeline for d1guba_:

• d1guba_ first appeared in SCOP 1.65
  
• d1guba_ appears in SCOP 1.71
  
• d1guba_ appears in SCOP 1.75
  
• d1guba_ appears in the current release, SCOPe 2.08