SCOP 1.71: Domain d1gska3: 1gsk A:357-510

Lineage for d1gska3 (1gsk A:357-510)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (7 PDB entries)

8. Domain d1gska3: 1gsk A:357-510 [83316]
   complexed with c1o, c2o, cu, gol

Details for d1gska3

PDB Entry: 1gsk, 1.7 Å

PDB Description: crystal structure of cota, an endospore coat protein from bacillus subtilis

SCOP Domain Sequences for d1gska3:

Sequence; same for both SEQRES and ATOM records:

>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd

Timeline for d1gska3:

• d1gska3 first appeared in SCOP 1.65
  
• d1gska3 appears in SCOP 1.69
  
• d1gska3 appears in SCOP 1.73
  
• d1gska3 appears in the current release, SCOPe 2.08