Lineage for d1gpqb_ (1gpq B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423302Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 423303Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 423304Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 423305Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 423306Species Escherichia coli [TaxId:562] [89875] (1 PDB entry)
  8. 423308Domain d1gpqb_: 1gpq B: [83296]
    Other proteins in same PDB: d1gpqc_, d1gpqd_
    complexed with lysozyme

Details for d1gpqb_

PDB Entry: 1gpq (more details), 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl

SCOP Domain Sequences for d1gpqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpqb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnfr

SCOP Domain Coordinates for d1gpqb_:

Click to download the PDB-style file with coordinates for d1gpqb_.
(The format of our PDB-style files is described here.)

Timeline for d1gpqb_: