SCOPe 2.03: Domain d1gpqa_: 1gpq A:

Lineage for d1gpqa_ (1gpq A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)
   automatically mapped to Pfam PF08816

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
   Uniprot P45502 31-157

8. Domain d1gpqa_: 1gpq A: [83295]
   Other proteins in same PDB: d1gpqc_, d1gpqd_
   complexed with lysozyme

Details for d1gpqa_

PDB Entry: 1gpq, 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl

PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1gpqa_:

Sequence; same for both SEQRES and ATOM records:

>d1gpqa_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnf

Timeline for d1gpqa_:

• d1gpqa_ first appeared in SCOP 1.65
  
• d1gpqa_ appears in SCOPe 2.02
  
• d1gpqa_ appears in SCOPe 2.04
  
• d1gpqa_ appears in the current release, SCOPe 2.08