Lineage for d1g3ma_ (1g3m A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393658Family c.37.1.5: PAPS sulfotransferase [52575] (10 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 393670Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species)
  7. 393671Species Human (Homo sapiens) [TaxId:9606] [75198] (2 PDB entries)
  8. 393672Domain d1g3ma_: 1g3m A: [83268]

Details for d1g3ma_

PDB Entry: 1g3m (more details), 1.7 Å

PDB Description: crystal structure of human estrogen sulfotransferase in complex with in-active cofactor pap and 3,5,3',5'-tetrachloro-biphenyl-4,4'-diol

SCOP Domain Sequences for d1g3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens)}
seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk
egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc
kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg
ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl
pdeimnqklspfmrkgitgdwknhftvalnekfdkhyeqqmkestlkfrt

SCOP Domain Coordinates for d1g3ma_:

Click to download the PDB-style file with coordinates for d1g3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ma_: