Lineage for d1fnxh2 (1fnx H:121-208)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862116Protein Hu antigen C (Huc) [54940] (1 species)
  7. 862117Species Mouse (Mus musculus) [TaxId:10090] [54941] (3 PDB entries)
  8. 862119Domain d1fnxh2: 1fnx H:121-208 [83254]

Details for d1fnxh2

PDB Entry: 1fnx (more details)

PDB Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element
PDB Compounds: (H:) hu antigen c

SCOP Domain Sequences for d1fnxh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnxh2 d.58.7.1 (H:121-208) Hu antigen C (Huc) {Mouse (Mus musculus) [TaxId: 10090]}
sirdanlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieae
eaikglngqkplgaaepitvkfannpsq

SCOP Domain Coordinates for d1fnxh2:

Click to download the PDB-style file with coordinates for d1fnxh2.
(The format of our PDB-style files is described here.)

Timeline for d1fnxh2: