SCOPe 2.05: Domain d1fnxh1: 1fnx H:35-120

Lineage for d1fnxh1 (1fnx H:35-120)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Hu antigen C (Huc) [54940] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [54941] (3 PDB entries)

8. Domain d1fnxh1: 1fnx H:35-120 [83253]
   protein/RNA complex

Details for d1fnxh1

PDB Entry: 1fnx

PDB Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element

PDB Compounds: (H:) hu antigen c

SCOPe Domain Sequences for d1fnxh1:

Sequence; same for both SEQRES and ATOM records:

>d1fnxh1 d.58.7.1 (H:35-120) Hu antigen C (Huc) {Mouse (Mus musculus) [TaxId: 10090]}
mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
kaintlnglklqtktikvsyarpssa

Timeline for d1fnxh1:

• d1fnxh1 first appeared in SCOP 1.65
  
• d1fnxh1 appears in SCOPe 2.04
  
• d1fnxh1 appears in SCOPe 2.06
  
• d1fnxh1 appears in the current release, SCOPe 2.08