Lineage for d1fnxh1 (1fnx H:35-120)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (16 proteins) 
Protein Hu antigen C (Huc) [54940] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54941] (3 PDB entries) 
Domain d1fnxh1: 1fnx H:35-120 [83253]
Details for d1fnxh1
PDB Entry: 1fnx (more details)
PDB Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element
SCOP Domain Sequences for d1fnxh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnxh1 d.58.7.1 (H:35-120) Hu antigen C (Huc) {Mouse (Mus musculus)}
mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
kaintlnglklqtktikvsyarpssa
SCOP Domain Coordinates for d1fnxh1:
Click to download the PDB-style file with coordinates for d1fnxh1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnxh1:
- d1fnxh1 is new in SCOP 1.65
- d1fnxh1 appears in SCOP 1.67
- d1fnxh1 appears in the current release, SCOPe 2.08
View in 3D
