Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (24 proteins) consist of a number of sequence families |
Protein Beta-1,4-galactanase [89469] (4 species) |
Species Fungus (Aspergillus aculeatus) [TaxId:5053] [89470] (2 PDB entries) |
Domain d1fhla_: 1fhl A: [83252] |
PDB Entry: 1fhl (more details), 2.3 Å
SCOP Domain Sequences for d1fhla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhla_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} altyrgadisslllledegysyknlngqtqaletiladaginsirqrvwvnpsdgsydld ynlelakrvkaagmslyldlhlsdtwadpsdqttpsgwsttdlgtlkwqlynytlevcnt faendidieiisigneiragllwplgetssysnigallhsgawgvkdsnlattpkimihl ddgwswdqqnyfyetvlatgellstdfdyfgvsyypfysasatlaslktslanlqstydk pvvvvetnwpvscpnpayafpsdlssipfsvagqqefleklaavveattdglgvyywepa wignaglgsscadnlmvdyttdevyesietlgel
Timeline for d1fhla_: