Lineage for d1f9ya_ (1f9y A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863675Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 863676Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 863677Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 863678Species Escherichia coli [TaxId:562] [55086] (19 PDB entries)
    Uniprot P26281
  8. 863679Domain d1f9ya_: 1f9y A: [83249]
    complexed with act, apc, cl, hhr, mg

Details for d1f9ya_

PDB Entry: 1f9y (more details), 0.89 Å

PDB Description: Crystal structure of the ternary complex of E. coli HPPK with MgAMPCPP and oxidation products of 6-hydroxymethyl-7,8-dihydropterin
PDB Compounds: (A:) protein (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase)

SCOP Domain Sequences for d1f9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ya_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d1f9ya_:

Click to download the PDB-style file with coordinates for d1f9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ya_: