Lineage for d1f55a_ (1f55 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1996875Protein Calmodulin [47516] (12 species)
  7. 1996901Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (4 PDB entries)
  8. 1996905Domain d1f55a_: 1f55 A: [83245]
    N-terminal domain, calcium bound form
    complexed with ca

Details for d1f55a_

PDB Entry: 1f55 (more details)

PDB Description: solution structure of the calcium bound n-terminal domain of yeast calmodulin
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1f55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f55a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlk

SCOPe Domain Coordinates for d1f55a_:

Click to download the PDB-style file with coordinates for d1f55a_.
(The format of our PDB-style files is described here.)

Timeline for d1f55a_: