Lineage for d1f54a_ (1f54 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 280971Family a.39.1.5: Calmodulin-like [47502] (18 proteins)
    Duplication: made with two pairs of EF-hands
  6. 280999Protein Calmodulin [47516] (9 species)
  7. 281011Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (3 PDB entries)
  8. 281013Domain d1f54a_: 1f54 A: [83244]
    N-terminal domain, apo form

Details for d1f54a_

PDB Entry: 1f54 (more details)

PDB Description: solution structure of the apo n-terminal domain of yeast calmodulin

SCOP Domain Sequences for d1f54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae)}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlk

SCOP Domain Coordinates for d1f54a_:

Click to download the PDB-style file with coordinates for d1f54a_.
(The format of our PDB-style files is described here.)

Timeline for d1f54a_: