Lineage for d1f38b_ (1f38 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612221Family c.66.1.22: Precorrin-6Y methyltransferase (CbiT) [82472] (1 protein)
  6. 1612222Protein Precorrin-6Y methyltransferase (CbiT) [82473] (1 species)
  7. 1612223Species Methanobacterium thermoautotrophicum [TaxId:145262] [82474] (5 PDB entries)
    MTH146
  8. 1612235Domain d1f38b_: 1f38 B: [83241]

Details for d1f38b_

PDB Entry: 1f38 (more details), 2.4 Å

PDB Description: x-ray crystallographic structure of precorrin 8w decarboxylase, the product of gene mt0146 in the methanobacterium thermoautotrophicum genome
PDB Compounds: (B:) precorrin-8w decarboxylase

SCOPe Domain Sequences for d1f38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f38b_ c.66.1.22 (B:) Precorrin-6Y methyltransferase (CbiT) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
liytgv

SCOPe Domain Coordinates for d1f38b_:

Click to download the PDB-style file with coordinates for d1f38b_.
(The format of our PDB-style files is described here.)

Timeline for d1f38b_: