![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein Viral capsid protein [50597] (3 species) |
![]() | Species Venezuelan equine encephalitis virus [TaxId:11036] [89347] (2 PDB entries) |
![]() | Domain d1ep6b_: 1ep6 B: [83190] |
PDB Entry: 1ep6 (more details), 2.45 Å
SCOP Domain Sequences for d1ep6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ep6b_ b.47.1.3 (B:) Viral capsid protein {Venezuelan equine encephalitis virus} vmklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleya dvpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvv aivlggvnegsrtalsvvmwnekgvtvkytpenceqw
Timeline for d1ep6b_: