Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (30 PDB entries) |
Domain d1eezd2: 1eez D:1-181 [83180] Other proteins in same PDB: d1eeza1, d1eezb_, d1eezd1, d1eeze_ mutant |
PDB Entry: 1eez (more details), 2.3 Å
SCOP Domain Sequences for d1eezd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eezd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1eezd2:
View in 3D Domains from other chains: (mouse over for more information) d1eeza1, d1eeza2, d1eezb_, d1eeze_ |