SCOPe 2.05: Domain d1b4pa2: 1b4p A:1-84

Lineage for d1b4pa2 (1b4p A:1-84)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)

8. Domain d1b4pa2: 1b4p A:1-84 [83159]
   Other proteins in same PDB: d1b4pa1
   chimeric isozyme
   complexed with gps, so4

Details for d1b4pa2

PDB Entry: 1b4p, 1.7 Å

PDB Description: crystal structures of class mu chimeric gst isoenzymes m1-2 and m2-1

PDB Compounds: (A:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1b4pa2:

Sequence; same for both SEQRES and ATOM records:

>d1b4pa2 c.47.1.5 (A:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d1b4pa2:

• d1b4pa2 first appeared in SCOP 1.65
  
• d1b4pa2 appears in SCOPe 2.04
  
• d1b4pa2 appears in SCOPe 2.06
  
• d1b4pa2 appears in the current release, SCOPe 2.08