SCOP 1.69: Domain d1b4pa1: 1b4p A:85-217

Lineage for d1b4pa1 (1b4p A:85-217)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d1b4pa1: 1b4p A:85-217 [83158]
   Other proteins in same PDB: d1b4pa2
   chimeric isozyme

Details for d1b4pa1

PDB Entry: 1b4p, 1.7 Å

PDB Description: crystal structures of class mu chimeric gst isoenzymes m1-2 and m2-1

SCOP Domain Sequences for d1b4pa1:

Sequence; same for both SEQRES and ATOM records:

>d1b4pa1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeerirvdvlenqamdtrlqlamvcyspdferkkpeyleglpekmklyseflgkq
pwfagnkityvdflvydvldqhrifepkcldafpnlkdfvarfeglkkisdymksgrfls
kpifakmafwnpk

Timeline for d1b4pa1:

• d1b4pa1 first appeared in SCOP 1.65
  
• d1b4pa1 appears in SCOP 1.67
  
• d1b4pa1 appears in SCOP 1.71
  
• d1b4pa1 appears in the current release, SCOPe 2.08