SCOP 1.65: Domain d1ku2a1: 1ku2 A:273-332

Lineage for d1ku2a1 (1ku2 A:273-332)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families)

5. Family a.4.13.1: Sigma3 domain [88660] (2 proteins)

6. Protein Sigma factor SigA [88663] (1 species)

7. Species Thermus aquaticus [TaxId:271] [88664] (1 PDB entry)

8. Domain d1ku2a1: 1ku2 A:273-332 [83096]
   Other proteins in same PDB: d1ku2a2, d1ku2b2

Details for d1ku2a1

PDB Entry: 1ku2, 2.9 Å

PDB Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1

SCOP Domain Sequences for d1ku2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ku2a1 a.4.13.1 (A:273-332) Sigma factor SigA {Thermus aquaticus}
iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl

Timeline for d1ku2a1:

• d1ku2a1 is new in SCOP 1.65
  
• d1ku2a1 appears in SCOP 1.67
  
• d1ku2a1 appears in the current release, SCOPe 2.08