SCOPe 2.08: Domain d1k5m.1: 1k5m D:,B:

Lineage for d1k5m.1 (1k5m D:,B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (36 PDB entries)

8. Domain d1k5m.1: 1k5m D:,B: [83093]
   grafted HIV-1 v3 loop in chain B
   complexed with sph

Details for d1k5m.1

PDB Entry: 1k5m, 2.7 Å

PDB Description: crystal structure of a human rhinovirus type 14:human immunodeficiency virus type 1 v3 loop chimeric virus mn-iii-2

PDB Compounds: (B:) CHIMERA OF HRV14 COAT PROTEIN VP2 (P1B) AND the V3 loop of HIV-1 gp120, (D:) coat protein vp4 (p1a)

SCOPe Domain Sequences for d1k5m.1:

Sequence; same for both SEQRES and ATOM records:

>g1k5m.1 b.121.4.1 (D:,B:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
inyykdaastssagqslsmdpskftepvkdlmlkgapalnXgysdrvqqitlgnstittq
eaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytldsktwttgskgwcwklpdal
kdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvipehqlasheggnvsvkytf
thpgergidlssaadtigpgrafyttknnevggpvkdviynmngtllgnllifphqfinl
rtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapmctef
sgirsksivpq

Timeline for d1k5m.1:

• d1k5m.1 first appeared in SCOP 1.65
  
• d1k5m.1 appears in SCOPe 2.07