Lineage for d1hwwa1 (1hww A:412-522)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278744Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (3 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 278778Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (2 families) (S)
  5. 278779Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organisation is similar to that of the 4-alpha-glucanotransferase family
  6. 278780Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 278781Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (3 PDB entries)
  8. 278784Domain d1hwwa1: 1hww A:412-522 [83067]
    Other proteins in same PDB: d1hwwa2, d1hwwa3
    complexed with mpd, nag, swa, zn

Details for d1hwwa1

PDB Entry: 1hww (more details), 1.87 Å

PDB Description: golgi alpha-mannosidase ii in complex with swainsonine

SCOP Domain Sequences for d1hwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwwa1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOP Domain Coordinates for d1hwwa1:

Click to download the PDB-style file with coordinates for d1hwwa1.
(The format of our PDB-style files is described here.)

Timeline for d1hwwa1: