SCOP 1.67: Domain d1h6w.2: 1h6w A:328-396,B:518-527

Lineage for d1h6w.2 (1h6w A:328-396,B:518-527)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.231: Receptor-binding domain of short tail fibre protein gp12 [88873] (1 superfamily)
   unusual fold; trimer

4. Superfamily d.231.1: Receptor-binding domain of short tail fibre protein gp12 [88874] (1 family)

5. Family d.231.1.1: Receptor-binding domain of short tail fibre protein gp12 [88875] (1 protein)

6. Protein Receptor-binding domain of short tail fibre protein gp12 [88876] (1 species)
   intertwinned homotrimer; subdivided into the neck, collar, head and bonnet regions

7. Species Bacteriophage T4 [TaxId:10665] [88877] (2 PDB entries)

8. Domain d1h6w.2: 1h6w A:328-396,B:518-527 [83059]
   Other proteins in same PDB: d1h6wa1
   neck and collar regions only

Details for d1h6w.2

PDB Entry: 1h6w, 1.9 Å

PDB Description: crystal structure of a heat- and protease-stable fragment of the bacteriophage t4 short fibre

SCOP Domain Sequences for d1h6w.2:

Sequence; same for both SEQRES and ATOM records:

>g1h6w.2 d.231.1.1 (A:328-396,B:518-527) Receptor-binding domain of short tail fibre protein gp12 {Bacteriophage T4}
gkrvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggss
snpglpdmrXslnyiikvke

Timeline for d1h6w.2:

• d1h6w.2 first appeared in SCOP 1.65
  
• d1h6w.2 appears in SCOP 1.69
  
• d1h6w.2 appears in the current release, SCOPe 2.08