Lineage for d1h6w.2 (1h6w A:328-396,B:518-527)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338475Fold d.231: Receptor-binding domain of short tail fibre protein gp12 [88873] (1 superfamily)
    unusual fold; trimer
  4. 338476Superfamily d.231.1: Receptor-binding domain of short tail fibre protein gp12 [88874] (1 family) (S)
  5. 338477Family d.231.1.1: Receptor-binding domain of short tail fibre protein gp12 [88875] (1 protein)
  6. 338478Protein Receptor-binding domain of short tail fibre protein gp12 [88876] (1 species)
    intertwinned homotrimer; subdivided into the neck, collar, head and bonnet regions
  7. 338479Species Bacteriophage T4 [TaxId:10665] [88877] (2 PDB entries)
  8. 338481Domain d1h6w.2: 1h6w A:328-396,B:518-527 [83059]
    Other proteins in same PDB: d1h6wa1
    neck and colar regions only

Details for d1h6w.2

PDB Entry: 1h6w (more details), 1.9 Å

PDB Description: crystal structure of a heat- and protease-stable fragment of the bacteriophage t4 short fibre

SCOP Domain Sequences for d1h6w.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1h6w.2 d.231.1.1 (A:328-396,B:518-527) Receptor-binding domain of short tail fibre protein gp12 {Bacteriophage T4}
gkrvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggss
snpglpdmrXslnyiikvke

SCOP Domain Coordinates for d1h6w.2:

Click to download the PDB-style file with coordinates for d1h6w.2.
(The format of our PDB-style files is described here.)

Timeline for d1h6w.2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6wa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1h6wa1