Lineage for d1h2ha4 (1h2h A:1-108,A:220-241)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308731Protein Hypothetical protein TM1643 [75108] (1 species)
  7. 308732Species Thermotoga maritima [TaxId:243274] [75109] (2 PDB entries)
  8. 308734Domain d1h2ha4: 1h2h A:1-108,A:220-241 [83058]
    Other proteins in same PDB: d1h2ha3
    complexed with mse, nad

Details for d1h2ha4

PDB Entry: 1h2h (more details), 2.6 Å

PDB Description: crystal structure of tm1643

SCOP Domain Sequences for d1h2ha4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ha4 c.2.1.3 (A:1-108,A:220-241) Hypothetical protein TM1643 {Thermotoga maritima}
mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea
vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgXsmltvysilrt
lrnleskiifg

SCOP Domain Coordinates for d1h2ha4:

Click to download the PDB-style file with coordinates for d1h2ha4.
(The format of our PDB-style files is described here.)

Timeline for d1h2ha4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h2ha3