Lineage for d1ev1.1 (1ev1 4:,2:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569151Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 569256Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 569257Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 569277Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 569286Species Human echovirus 1 [TaxId:46633] [49685] (1 PDB entry)
  8. 569287Domain d1ev1.1: 1ev1 4:,2: [83050]

Details for d1ev1.1

PDB Entry: 1ev1 (more details), 3.55 Å

PDB Description: echovirus 1

SCOP Domain Sequences for d1ev1.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ev1.1 b.121.4.1 (4:,2:) Human enterovirus B coat proteins {Human echovirus 1}
xgaqvstqktgahetsiihytninyykdaasnsanrqdftqdpgkftepmkdvmiktlpa
lnXgysdrvrsitlgnstittqecanvvvgygewpeylsdneataedqptqpdvatcrfy
tldsvqwengspgwwwkfpdalrdmglfgqnmyyhylgragytihvqcnaskfhqgcilv
vcvpeaemgsaqtsgvvnyehiskgeiasrftttttaedhgvqaavwnagmgvgvgnlti
fphqwinlrtnnsativmpyvnsvpmdnmyrhhnftlmiipfvpldfsagastyvpitvt
vapmcaeynglrlaghq

SCOP Domain Coordinates for d1ev1.1:

Click to download the PDB-style file with coordinates for d1ev1.1.
(The format of our PDB-style files is described here.)

Timeline for d1ev1.1: